LL-37

154947-66-7 Basic information More..

Product Name:	LL-37
Synonyms:	Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS:	154947-66-7
MF:	C205H340N60O53
MW:	0
EINECS:	211-519-9
Mol File:	Mol File

LL-37 manufacturers

Information Error Report

Your Email:

Browse by province 154947-66-7 Suppliers

154947-66-7 Recommend Suppliers

Recommend You Select Member Companies...

Company Name:	Shanghai Getian Industrial Co., LTD Recommend Complaint

Tel:	+86-15373193816
FAX:
Email:	mike@ge-tian.com
Nationality:	China
Products Intro:	Product Name:LL-37 CAS:154947-66-7 Purity:99% Package:1Box;22USD
CB Index:	58
WebSite:	www.sh-getian.com
Related Information:	Sales Network Catalog(269) User Evaluation

Company Name:	Strong peptide cross-border e-commerce Co. LTD Recommend Complaint

Tel:
FAX:
Email:	qt01@qiangtaipharm.com
Nationality:	China
Products Intro:	Product Name:LL-37 CAS:154947-66-7 Purity:99.9% Package:1box;85.00;USD\|5box;80.00;USD\|10box;78.00;USD
CB Index:	58
WebSite:
Related Information:	Sales Network Catalog(84) User Evaluation

Company Name:	Qingdao Xinli Technology Development Co., Ltd. Recommend Complaint

Tel:
FAX:
Email:	xinlikeji01@qdxlchem.com
Nationality:	China
Products Intro:	Product Name:LL-37 CAS:154947-66-7 Purity:99.9% Package:≥1Box;$80.00/Box\|≥100Box;$75.00/Box\|≥1000Box;$70.00/Box
CB Index:	58
WebSite:
Related Information:	Sales Network Catalog(124) User Evaluation

Company Name:	Shandong Huizhihan Supply Chain Co., Ltd Recommend Complaint

Tel:
FAX:
Email:	3957328362@qq.com
Nationality:	China
Products Intro:	Product Name:LL-37 CAS:154947-66-7 Purity:99.99% Package:1BOX\|10BOX\|100BOX
CB Index:	58
WebSite:	www.yuhua99.com/manufacturer/shandong-huizhihan-supply-chain-25414/
Related Information:	Sales Network Catalog(300) User Evaluation

Company Name:	Hebei Jiafan Trading Company Limited Recommend Complaint

Tel:
FAX:
Email:	sales01@jiafan88.com
Nationality:	China
Products Intro:	Product Name:LL37 CAS:154947-66-7 Purity:99.99% Package:1BOX;5.00;USD
CB Index:	58
WebSite:
Related Information:	Sales Network Catalog(138) User Evaluation

Company Name:	Shenzhen Aoxi Technology Co., Ltd. Recommend Complaint

Tel:	+852-46424790
FAX:
Email:	frank88rawpowder@outlook.com
Nationality:	China
Products Intro:	Product Name:LL-37 5mg (CAP-18) CAS:154947-66-7 Purity:99% Package:1kit;30USD\|20kit;20USD\|100kit;10USD
CB Index:	58
WebSite:
Related Information:	Sales Network Catalog(133) User Evaluation

Company Name:	Shanghai Yunao International Trade Co., Ltd Recommend Complaint

Tel:
FAX:
Email:	asdf@shanghaihg.cn
Nationality:	China
Products Intro:	Product Name:LL 37 CAS:154947-66-7 Purity:99.9% Package:1g;30USD
CB Index:	58
WebSite:	www.yuhua99.com/manufacturer/shanghai-yunao-international-trade-414/product_0_1.htm
Related Information:	Sales Network Catalog(264) User Evaluation

Company Name:	Shaanxi Franta Biotechnology Co., Ltd Recommend Complaint

Tel:	+86-13082019107
FAX:
Email:	admin@flanderff.com
Nationality:	China
Products Intro:	Product Name:LL37 CAS:154947-66-7 Purity:99 Package:1kg;20USD
CB Index:	58
WebSite:
Related Information:	Sales Network Catalog(244) User Evaluation

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

Tag: 154947-66-7

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.